DPCstruct | MC32335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 2.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.19 |
| Pfam Score | 77.22 |
| Assigned Pfam label(s) | PF16420- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1PI60 | 21-84 | FAHIPMPGYPVGEDLMEEMYNNVKLVTDAIVEHDVIFLLLDSREARWLPTVIAALHGKVTFILR |
| A0A2J6KJ90 | 1-63 | MAIPMPGHPIARQEEEKVFDDCKCLSDLIESPDAVLLLTDTCEIRWLPTLLCANANKGTWQMQ |
| A0A453BZ73 | 60-118 | None |
| A0A5N4D018 | 122-184 | None |
| A0A453BZ78 | 245-309 | None |
| A0A1A6H8S9 | 69-131 | None |
| A0A7J7JJ68 | 211-275 | None |
| A0A167F2I2 | 212-270 | None |
| A0A146I083 | 713-773 | None |
| A0A5B7J3P4 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.