DPCstruct | MC32332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 81.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6KDH4 | 2-110 | QCLSVMNCWLKCMMLDPYNKTDHPECKSRPDSGISSITELDSCYITGPLSSVWKEWCIEFGIEANDILAVPYDWRLLPSKLEEWDLY… |
| A0A0A9DAL2 | 2-91 | LLEPYNQTDHPECKSRPDSGLSAITELDPGYITGPLSSVWKEWVKWCVEFGIEANAIIAVPYDWRLPPSMLEERDLYFHKLKLTFEI… |
| A0A1D6G1S4 | 2-85 | None |
| A0A6S7MRE3 | 8-87 | None |
| A0A830C5Q6 | 34-114 | None |
| A0A2U1QPL5 | 94-176 | None |
| A0A164Z3F9 | 12-116 | None |
| A0A3Q7XNS2 | 2-91 | None |
| A0A5D3BSV7 | 49-145 | None |
| A0A6S7NVX1 | 4-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.