DPCstruct | MC32331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 171 ± 14 aa |
| Standard deviation of domain lengths | 14.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4WGA8 | 1-161 | MERASLSLSAVKSLVLRDKEDKLASELGDNEKVLSLMHSLFDAEGNFLRRKICMDSEAVANMTNLPREIHGAPPESFIVKLSEVIGS… |
| A0A2J6KB99 | 1-180 | MVRSMKDLLMSSRDSSPVREKAGLNFSTVKSLVLRDKEDKIDMEFGTDEKVKVVSLISSLLGAEGHLSGRKSTPKLETNPTIISLLK… |
| A0A453BES9 | 20-190 | None |
| A0A453BES2 | 1-172 | None |
| A0A368FAZ6 | 35-182 | None |
| A0A0D2U4F7 | 44-243 | None |
| A0A1D6ICN7 | 1-172 | None |
| A0A3P6RLS9 | 26-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.