DPCstruct | MC32330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 205 ± 42 aa |
| Standard deviation of domain lengths | 42.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12452 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524RSB8 | 3-187 | GALVSAEPVLVEGALVAPDQPRALFHLELLLSDWLLGMAIVVAEVVIESCSSWPELRRVMLDPEYLPTRNLERLRNQINTRTRLINL… |
| A0A2I7YWB7 | 31-237 | LKLNEFTKSFYVKNLLEEIDIIFKVPFYAILNSKAAEFLLVYYPVYNYASENFLEALIDHLVIEIANCVAYVTLVNFSFLYSFRQTL… |
| A0A7C9PWN5 | 431-635 | None |
| Q0WNJ8 | 4-285 | None |
| T2JU06 | 207-415 | None |
| A0A1C9CE25 | 2-133 | None |
| A0A6M0F9T4 | 22-216 | None |
| A4SBZ2 | 84-265 | None |
| A0A059XLS9 | 2-189 | None |
| A0A5J4YDW3 | 144-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.