DPCstruct | MC3233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E2H741 | 1-101 | MKKNGVSAPIPYADDCTDRDTTLRSIQEYLSPQYQLRWYMGSLGSDTLAFCIYPTSEWEQIEQEFGAEKVAYYFAPVQANSVMFEMD… |
| D1AJW7 | 93-168 | GSSFDIRLSFSGADRYITIRSFNEIISSDYEIRLFDSSFYSDTHVFLILPKSWWNDLDNRFGEKVSGIFTVITEGL |
| L9MP35 | 49-125 | None |
| F9EP07 | 2-106 | None |
| A0A7W4EXW5 | 50-171 | None |
| A0A5K7XGM4 | 163-265 | None |
| N9L8L1 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.