DPCstruct | MC32328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF13351- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2YIT8 | 7-83 | HIYKTEQIDWEKLESVGISRSQIEKDGNMDLLLQGEETNVMSIKIKTPVFSLTMDATLSLIEDENGNPVISVNGINP |
| A0A2X2JSA0 | 16-98 | TKSAYKYKVEEIDWTSLEKLNLNRALLEKNGQLDKLLKGYKSDGIYRIEGNFDGIVMKGDARLSLRKPKDSDQVVVMAHGVRL |
| A0A6N2UEX8 | 17-99 | None |
| A0A6C0GRQ8 | 181-266 | None |
| A0A7D4B645 | 316-402 | None |
| A0A401LZ27 | 4-94 | None |
| A0A495UP94 | 292-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.