DPCstruct | MC32326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 60.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8D0L5 | 3-51 | DSRFHPVAYNVGVNVGVAAGQSVFHAHIHVIPRYEGDVTNPLGGVRNVK |
| A0A382L0X3 | 49-110 | DTVRELLLERFNPDGFNIGVNTNEAAGQTVDHAHIHLIPRYQGDVEDPRGGIRWVIPGKAPY |
| A0A4U1JAK9 | 165-226 | None |
| A0A4Y8SYQ5 | 2-54 | None |
| A0A1M5YA60 | 137-194 | None |
| A1ZIJ2 | 10-62 | None |
| A0A182AQM8 | 21-67 | None |
| A0A2N2H3T7 | 401-456 | None |
| A0A063ZA11 | 154-214 | None |
| A0A2V1P4E2 | 171-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.