DPCstruct | MC32322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9VKI5 | 1-50 | MKVELIDVVRGLALCADEHGERATVEVELVAPVAVGDQILVHAGTALVRL |
| A0A1Q4DI54 | 1-69 | MCLGIPGEVVALLDGDLATVRVEGVERPINVGMLNDGEAVPGRWVLVHLGFAMSVVDRDEATASLDFVT |
| H6SN22 | 1-79 | None |
| A0A6G3HIK1 | 1-59 | None |
| A0A327KTL6 | 38-138 | None |
| A0A117E6C3 | 1-81 | None |
| A0A357NG42 | 1-68 | None |
| T5I491 | 2-70 | None |
| H6SN16 | 43-115 | None |
| Q20XQ3 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.