DPCstruct | MC32320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365Z3U6 | 27-155 | LPKLTRREPARGPARFEHRSLVRPYARTGGRTRPGQDLQLESLVTTSERGRRYLGAATTVQRFICDLCVEVRSVAEVAAYSRLPLNV… |
| A0A0M8QYK4 | 2-107 | RPYVVTRGRATPARRLPPETLLVAADTDRVLPLTASRQERDLLSRCRRATVSLAEAAAHVGLPVSVVSVLVCQLLDDGFLVTRAPIE… |
| A0A263DJ50 | 33-160 | None |
| A0A7K1LBB9 | 146-277 | None |
| A0A7Z0PUA3 | 9-139 | None |
| A0A543IB85 | 51-190 | None |
| A0A2E6VP08 | 9-112 | None |
| A0A1A0N866 | 190-315 | None |
| A0A5D0TQR3 | 18-147 | None |
| A0A4R6V369 | 3-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.