DPCstruct | MC3232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 252 ± 34 aa |
| Standard deviation of domain lengths | 34.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 52.38 |
| Assigned Pfam label(s) | PF14191- PF18830- PF18832- PF14195 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E2H0S2 | 902-1173 | GDVKQLYAKAQETAQTTGQDKDTFSIYQIKGGDETRDFRFEPYDRLQAAGNVVDKANYELVYSAPLAPETSLEDIYTRFNIDHPKDF… |
| A0A358PVE2 | 8-204 | RFYENTSGLDAEALCKAYAECDKPFVEMGQYGKPISEADYAYIQQGDRLSFSLEFDADKDAITISDGEHFETKGLMETLFPQKTEPK… |
| A0A3D0XA08 | 293-535 | None |
| A0A416JJB5 | 699-927 | None |
| A0A7X2NPM6 | 309-588 | None |
| A0A3E5ALJ8 | 17-247 | None |
| A0A316NF74 | 2-210 | None |
| A0A1Y4BDN2 | 950-1231 | None |
| A0A2U1CC04 | 174-378 | None |
| D4KLU0 | 21-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.