DPCstruct | MC32310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 251 ± 51 aa |
| Standard deviation of domain lengths | 50.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03034 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7P3D4 | 70-376 | SITVLVGMLAALVYVAAVEDVKLDTAFNIKRGMTACVIAFCMFGMTQAKDGPFKRPHPAIWRFFLCLSIIYELFLVFLLFQSVDDAR… |
| L8H775 | 77-375 | LAISNIVLFITHQSLSVYFHPETVSLATSPVPPLVPHSWRGRIGRQLMLGFEFLTNKLGVTVLCAQLGFILHLFLLSPAEGRLEMSV… |
| T1G063 | 46-348 | None |
| A0A452TG90 | 134-353 | None |
| A0A1R2CFN4 | 35-289 | None |
| A0A835RBS4 | 22-289 | None |
| A0A3P7YLE3 | 2-205 | None |
| A0A7R9AM70 | 53-282 | None |
| A0A7J6LI42 | 78-379 | None |
| A0A0Q3Q947 | 35-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.