DPCstruct | MC3231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 139 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9FKK3 | 126-276 | VRDWPDATLELLCGGGWHGVLPLRPLPAPDAPRVKAYRKHAREGTLAPVLLWWVSFLDGWLLLDGHDRAAAALVEGMQPACVELVRV… |
| A0A4S2J6B0 | 13-149 | CGGGWHGVVPLRRLSAPDAARVKAYRKHAREGTLAPVLLWWVPFLDGWLILDGHDRAVAALAEGGPPKCVVLTRLPEEARWREEAER… |
| A0A7U8V113 | 7-139 | None |
| A0A4D4MNF6 | 221-356 | None |
| K4RCF4 | 87-211 | None |
| A0A0S2FSZ5 | 276-420 | None |
| A0A239KCH9 | 113-262 | None |
| A0A7V8TRX4 | 120-255 | None |
| A0A6G3XQY2 | 34-165 | None |
| A0A7S2YLD4 | 231-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.