DPCstruct | MC32309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 21.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8GXA0 | 11-133 | LLAAVAVSLCAACTQPSCTTGTYGLIPGFTPTSNGCGSYGVSIDAPFGVTPCCNQHDICYHSCNTSKSDCDDRFDQCMKDVCDSEDD… |
| A0A3M1QUQ2 | 275-362 | PCEPNGCSFSPDAPCGYDFSRACDAHDLCYCTCGRTKDQCDDWLCEDLHFTCRFYYYDAFLCHRLADIYCLAVKVAGQSFFCDAQAEA |
| A0A3M7PGB5 | 36-175 | None |
| K1Q4Y2 | 9-134 | None |
| K1PPA5 | 24-153 | None |
| C1E6D1 | 19-172 | None |
| A0A2H1J3K5 | 1-89 | None |
| A0A5J4Z298 | 73-209 | None |
| A0A7M7LLI4 | 62-218 | None |
| A0A7V9DMD1 | 20-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.