DPCstruct | MC32305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 527 ± 35 aa |
| Standard deviation of domain lengths | 34.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4Q630 | 3-483 | NVNISNDLMESAVEAILSYKDHNRPDGSGIYTFWPQIYNQTKGIYTIFPVNLLNLMNTFGSFENAVDKVAQLFKWHGILEDMKLIAQ… |
| L8GNA8 | 1-535 | MTKTKRILFIFVVSLLVLTVHESQAAGAAKPGPTQQDAMIGKVYAAMQKEQVQHSQPFRPFPMQWREDRGLYRSSIHLDFVGQGWWD… |
| D3BDC5 | 651-1202 | None |
| A0A1F3XUT3 | 23-493 | None |
| F0ZZW5 | 1-572 | None |
| A0A0L0D5S4 | 394-941 | None |
| A0A1X7VN73 | 9-511 | None |
| A0A0G4H559 | 35-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.