DPCstruct | MC32304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 276 ± 34 aa |
| Standard deviation of domain lengths | 34.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673AQQ0 | 2-231 | YHNIRKKISPFVMSFGFRVFGVVLIVVDIMLVIVDLSLPQRSRDVGNALEAVSLIISFFFLFDVLLRVYVEGFKVYFSSKLNILDAC… |
| L8GM31 | 1-297 | MEAEALATKSSVPYVHLVDDDEAAGDAGDDRQNLLNRPHADHERQFKELEKRQQELYMPGWRGHLHRSRGRLRVILDSLPWQAVIIF… |
| A9URU8 | 319-606 | None |
| A0A6P4Y8E9 | 59-348 | None |
| A0A8B6ESY4 | 609-856 | None |
| A0A7R9PXU5 | 1-326 | None |
| A0A812Q1D9 | 369-700 | None |
| L8GG82 | 2-233 | None |
| A0A7S0QWI2 | 4-260 | None |
| A0A196S7K3 | 76-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.