DPCstruct | MC32303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 346 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 99.58 |
| Assigned Pfam label(s) | CL0023- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5W5C7 | 9-110 | LPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQREFGVPKVLEPEYLASPWLDELSGMTYLSYFMK… |
| L8GGH8 | 5-119 | QAALLAWAQRCTEGYKGVNITNFTSSWRDGLAFAALVHNHHPESFDYEPLVNGADALKRLEVAFEAAGKAGVPNLLDPEDVLVGPQP… |
| A0A0K0EEA2 | 152-292 | None |
| H3B992 | 506-640 | None |
| A0A2C9K361 | 207-330 | None |
| A0A7M5WZY0 | 125-241 | None |
| A0A3Q0JIR1 | 130-235 | None |
| A0A553P5K7 | 89-209 | None |
| A0A6P5W7I9 | 764-889 | None |
| T1EIK6 | 3-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.