DPCstruct | MC32302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 172 ± 38 aa |
| Standard deviation of domain lengths | 37.68 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.76 |
| Pfam Score | 88.64 |
| Assigned Pfam label(s) | PF05965- CL0489- PF05964- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S8DHT5 | 58-212 | KAKFPLEPEGGGRGASKIKLISAGSMKISNKYSQQYHNHKFLYPVGFHSVRLFDSVLDPNKQCGYSSFILEGEKGPLFRLAHEGGYP… |
| L8GFL6 | 11-178 | LLLPVARDEAGNPVLPITVKGTTILDLGEIVWDRPLFHSKQYLWPTGFKSTKRLPSISNPEEYTTYTSEIVDTGDDAPTFRVTPEDR… |
| A0A0K0EDE0 | 1902-2059 | None |
| A0A7M5WI18 | 114-298 | None |
| A0A397JS14 | 1-178 | None |
| A0A397JKI0 | 1-94 | None |
| A0A1U8EPY8 | 1-159 | None |
| A0A0Q9XHM3 | 2-149 | None |
| A0A1R0H742 | 312-510 | None |
| H3AZ42 | 280-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.