DPCstruct | MC32301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 370 ± 70 aa |
| Standard deviation of domain lengths | 70.12 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482V9D0 | 1-258 | MENKASPTTAQTSALVPWAKINVDIVALTQWNENLRKWISQTILERLVKEFDRVNESFEKQGLSDIKIGQVGLDRLRKTAQIAHVTH… |
| L8GF75 | 18-333 | YLARSPSAATGEEHTTEGGYLTSPLGGVGPGAEVRAYRVSPRSSPAKGRTGDEFGYFNTQAAQELVERLGVEGSMEEWTERTRQWLV… |
| A0A6A5DIH4 | 550-921 | None |
| A0A1R0GN43 | 37-390 | None |
| A0A1Y1VN28 | 351-729 | None |
| A0A7E4W1P4 | 188-565 | None |
| A0A0R3U3U9 | 40-345 | None |
| A0A0V0ZXB9 | 544-836 | None |
| A0A3R6WQ77 | 10-366 | None |
| A0A6P4HXE7 | 167-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.