DPCstruct | MC3230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 16 aa |
| Standard deviation of domain lengths | 16.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A429BMH8 | 2-161 | ITTYPTDGRLDGPIHTWFSLSYCNYAVLPRTLLQSMPVEFQERMVACLTELQAAFEHVPQAEVYDVKAATEHIVNEMSDVELKQAGI… |
| A0A4S2IX12 | 102-244 | PTGQPEPEAEAIHGHFGLSYANYLVLPRTLLQSMDDAWQTQFVALLNEMADAFQRVPQAEGYEVTTGQWMDLADMTESQLYAVGIDV… |
| A0A4V2YZH6 | 1-134 | None |
| A0A1I3Y2F3 | 29-164 | None |
| A0A1I2CQ59 | 24-164 | None |
| A0A286FA39 | 10-138 | None |
| A0A178X0E9 | 18-175 | None |
| A0A1E7LCV9 | 3-165 | None |
| A0A2N0EGV1 | 169-277 | None |
| A0A1H3SIC3 | 9-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.