DPCstruct | MC323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BBT0 | 4-119 | NFRVLKRDIPWETYMSTKLITSTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRSISKEETVEYVLALIDEMLAANPKRAAL… |
| A0A668U7J7 | 13-155 | TNIIAAKAAEVRANQVNWQSYLQSQMISTEDCEFIKKFEVASSDQKQVILTNEGHQCAKTFLNLMAHISKEQTVQYILTLIDDTLQE… |
| A0A7R8X781 | 1-149 | None |
| A0A7J0FVP6 | 1-152 | None |
| A0A182T430 | 22-137 | None |
| A0A815KBD8 | 24-194 | None |
| A0A4U0VMB8 | 277-403 | None |
| S4RQK2 | 2-104 | None |
| A0A7S0DB20 | 23-142 | None |
| A0A4Q2DLB0 | 10-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.