DPCstruct | MC32297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 4 aa |
| Standard deviation of domain lengths | 3.73 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379W2N3 | 12-113 | GAVALTCGLTAASTFAAGFQPAQPAGKLGAVVVDPYGNAPLTALVELDSHIISDVKVTVHGKGEKGVPVTYTVGKESLETYDGIPIF… |
| A0A6H6KUW3 | 1-112 | MRLSKTLCMALLAGSTLLAPNALMAMGGPSGAKIDWQIQGQIGAIKMNPYGLSPLTAIIMDNGYVLSDIKVTIVPKPNGQTISYNVN… |
| A0A447XRK6 | 8-113 | None |
| A0A381DJE2 | 1-100 | None |
| A0A381DKA7 | 6-105 | None |
| A0A5D4LET0 | 12-113 | None |
| A0A6H1UFP6 | 22-122 | None |
| A0A376LB92 | 8-113 | None |
| Q9L6L8 | 10-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.