DPCstruct | MC32296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5PHI3 | 2-113 | WQARFKFYDKFGHPASQNARAAAQQLDFWSRFLMRFNLWALLFSPIYFFIKGMWRKGLTLLALNIAAALGLSAAGWPNQWANLVAGA… |
| A0A285E1W7 | 3-115 | RFDFFAQHGLPGLWKNSPEWVAAFKALPFGRRMILQFNWLAAFFGFVYLFAKGLWRKAVAFIALGVAYGVVATFADTPVWLDRGAAI… |
| A0A6I4T882 | 45-172 | None |
| A0A4C4ZT87 | 8-121 | None |
| A0A5R8YTE4 | 9-138 | None |
| A0A7V4QB45 | 9-127 | None |
| A0A662Z7V5 | 78-198 | None |
| A0A2S8BGK2 | 10-125 | None |
| A0A3N6UMR9 | 2-135 | None |
| A0A1M7F6G9 | 10-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.