DPCstruct | MC32293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067SJB5 | 1-104 | MGRFADPYGDDNRLPAGMVWTGYDADTGERFYADRDGSTWVGAPWAEYGILKRLKGPPLRNGPSTTRAKKRQQYVNDLGTALCPAEP… |
| A0A0C3KR46 | 1-125 | MNRFTQFDEDSYRLPEGVKRIAYDADSQRYLFRDRHGQLYQNEPGDEYGVLQPVKCPIPPRRNVTIIEHRDPLLWEKQSNEVLKTFD… |
| A0A3S4C8F6 | 1-102 | None |
| A0A1C7LML4 | 1-108 | None |
| A0A6G1HL57 | 3-133 | None |
| A0A0C2YUM4 | 1-132 | None |
| A0A4S8LGS5 | 1-118 | None |
| G2RB74 | 1-100 | None |
| A0A137QR56 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.