DPCstruct | MC32292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3KHM0 | 1-119 | MLQGYFTQDTYHFSHLPFNFTTKESRAAYDTAASELASSLTTFAKVVIFLTTHTNEDRGDLFSGMENKVPIATEVFEFLQGLLLHFS… |
| A0A0C9TQ41 | 72-215 | QPTCIVHLRLSQISSGGPVNMLTEYLHPYFLHGTFYEINLEFDITMKAKMKSYLTFAVDAAASLEQTGLKNIIFAITNHSEDDTGGL… |
| A0A0C3CNR0 | 2-132 | None |
| A0A0D0D1G1 | 87-211 | None |
| A0A369JH51 | 155-255 | None |
| A0A0D0AR34 | 188-323 | None |
| A0A0C9YB06 | 15-134 | None |
| A0A0C9T005 | 208-315 | None |
| A0A0C3DQM0 | 152-270 | None |
| A0A0C9V374 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.