DPCstruct | MC32290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3ILZ0 | 3-164 | SLQATVMQIMVDIRNLTEGKMNLEEELTRLKEDNKMVTSHLDALEQSFAELQEKGEVALKQASSRTSSNDHTAVKSIIQPLFCQLCG… |
| A0A0C3P7U0 | 223-382 | MHSLQATVAQIMVDIRNLTEGKMHLEEELTRLREDNKTVTSRLDTLEQNFAELQEKGEVALKQASSRMSSNDHTAVKSIIQPLFCQL… |
| A0A0D0AP52 | 12-167 | None |
| A0A0D0AMM0 | 190-381 | None |
| A0A0D0CUZ8 | 120-296 | None |
| A0A1B7MJV8 | 2-140 | None |
| A0A1J8PRJ9 | 1-139 | None |
| A0A165M9T9 | 36-186 | None |
| A0A0C3NYB1 | 2-152 | None |
| A0A0D0DEH6 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.