DPCstruct | MC3229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 437 ± 74 aa |
| Standard deviation of domain lengths | 73.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 26.78 |
| Pfam Score | 86.41 |
| Assigned Pfam label(s) | CL0195- PF15447- PF21807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7M8P8 | 14-493 | RGAGSSGEEDKDAKNMFDRIGKIVHDKVKEEAKKYIEKLKGDLKKATNRSGETAYTLDPCMFDYTTHFDANSERHPCKNLKGITNEE… |
| W4IKB6 | 21-392 | LDKIGQQVHDKVHGDALQHSKGKLKGTLSEATFEEKPEGKQTPKDPCELKYGYHTTVTSGYDNENPCKYRPEVRFSYTEGAQCHSKK… |
| A0A024XBT1 | 65-459 | None |
| A0A0L7KJT5 | 237-619 | None |
| A0A0L7KK10 | 2-346 | None |
| A0A0L7KJM2 | 8-501 | None |
| A0A0L7KMG8 | 2-384 | None |
| A0A024WYH1 | 1-505 | None |
| A0A024WZ21 | 2-470 | None |
| A0A024VU96 | 352-727 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.