DPCstruct | MC32289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IBU6 | 151-238 | IAHMDRPLYLLGYMAKESRVYAVDKELNVVSYRLLLCVLEYQTAVMRRDFETADKVLATIPKEQRTRVAHFLEKQGFKRQALAVSQDP |
| A0A0C3IK25 | 16-95 | YILGYVPVHNRVYLADKDMNIYAYTLSLNVVEYQTAVLRGDMDSAAEILPSIPKEQLNKVARFLEARGMFLLSSSCPLQK |
| A0A0R3S5B2 | 49-116 | None |
| A0A6P7TUN9 | 19-86 | None |
| A0A7S0JPX2 | 235-316 | None |
| A0A7J6U002 | 577-644 | None |
| M4CH59 | 729-797 | None |
| A0A6A4KDS7 | 202-288 | None |
| A0A6A6LIS7 | 880-948 | None |
| A0A177U3T0 | 195-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.