DPCstruct | MC32286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 148 |
|---|---|
| Mean domain length (aa) | 181 ± 35 aa |
| Standard deviation of domain lengths | 34.96 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 97.98 |
| Assigned Pfam label(s) | CL0052- CL0126- CL0530- PF08718- PF02204 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4E2I4 | 2-141 | DYVAKVEDLAKASSSVSTLVVMMERDIEANCVRKAGSHTRNLLRVKRGLDMVKALFEEIIASEGDNSLKDPASKSYDQVFRPHHGWV… |
| A0A287N362 | 9-164 | TAVAEAFEELARGMEADGGELRLAPFGDTCALVSVLFNSLGIAFKFAESEYVTKVNDLIGASREYATLNDILDKDVENDSVKKQGSH… |
| F6GXJ5 | 8-140 | None |
| A0A654HQW9 | 2-155 | None |
| V7CX29 | 33-178 | None |
| A0A6A6L0T3 | 393-590 | None |
| A0A6G0X4D3 | 209-435 | None |
| A0A2U1QH50 | 212-380 | None |
| A0A5A9NB62 | 158-395 | None |
| A0A1I8FHM7 | 355-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.