DPCstruct | MC32284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4NJW3 | 1-94 | MRETGCTSHSDYGFNLPTQEPHPVNQFMKEWFAVRSNSGIRLCSYLGCGRPKTRKNEFLRCSLIGLMIYCSRAYQAIHWRLGHKVGC… |
| I3SL80 | 4-90 | PLIKENRYNVKVPEVHPVNWFLREWFESGLGILEDGLRLCAHIGCGRAETRPHEFRRCSVCGKVNYCFRACQALDWKLRHKMECSPM |
| A0A2I0X4H6 | 79-182 | None |
| A0A7J9D8Z1 | 32-129 | None |
| A0A6A3AS62 | 173-258 | None |
| A0A7J8X596 | 73-178 | None |
| A0A0U9HRE7 | 354-444 | None |
| A0A6A5LVZ1 | 152-272 | None |
| A0A226D1H6 | 235-325 | None |
| A0A251TZQ7 | 95-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.