DPCstruct | MC32282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453G8I2 | 182-244 | VPIFMISGAAEKIISFTNAVPEWLCKPRQEKLFSREEEALFGHVELLKEGKLSLFPHLYSKGL |
| A0A5D2ULJ5 | 373-435 | VPIYIISSVAEELLAFTNIIPEWLCKQRQEKLFSGEPLFAHVKLIKERKIHVFPAVHSVELLT |
| A0A068V9S6 | 6-74 | None |
| D7MYB5 | 82-144 | None |
| A0A2I0WL64 | 193-261 | None |
| A0A1R3HZA5 | 587-650 | None |
| A0A5N6PHP7 | 433-495 | None |
| A0A803Q4B8 | 652-716 | None |
| A0A446Q9E7 | 238-303 | None |
| A0A4Y7K3N9 | 274-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.