DPCstruct | MC32281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 215 ± 27 aa |
| Standard deviation of domain lengths | 26.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A163GP37 | 28-262 | DLYYHSDTARFVKIGSSADVERRNVILNSRLRNVPGQDLVDTSSTLWEMFSGPRGWQVTKQRYMEKYIKDTSKKTYVGGYDVQILTA… |
| A0A3D4QRQ8 | 111-332 | DLHYHASFNGKTNYYVALIPEGRNRDNPLFMELGNRFRNVPEKEIKDTARLLDINNIDSFKYKKDNIGWFDRITLSKYQRTFIGAQE… |
| A0A848M406 | 2-227 | None |
| A0A2R3MX84 | 676-897 | None |
| A0A1V0UX93 | 375-601 | None |
| A0A2K9E5A4 | 6-188 | None |
| A0A4Q2A4E7 | 889-1096 | None |
| A0A169Z8V2 | 557-791 | None |
| A0A7Y4ICL4 | 248-480 | None |
| A0A544V0C6 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.