DPCstruct | MC32276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 26 aa |
| Standard deviation of domain lengths | 25.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 94.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6CA24 | 95-232 | GHPAYYLPPEVNLIATAHYLEALRLQIKATRAIAVFGGKVPHTQFTISGGVTCYESLRPEKLEEYRTLTRETREFIEQMYIPDLLAV… |
| A0A259UCI6 | 16-168 | NDCRLNVEDNRRVASHYMEAVQISEKCHQLLTLFGGKAPHQHSFVHGGAAVAPTVDKINQALTLIRDIRKFIGRCLMPDTELIANCY… |
| A0A2X2C1C4 | 25-187 | None |
| A0A7C4JPW7 | 18-244 | None |
| A0A2C6MB53 | 30-197 | None |
| Q1NST7 | 2-135 | None |
| A0A2I0QG10 | 67-210 | None |
| A0A447PIK5 | 2-174 | None |
| A0A182SDU7 | 98-295 | None |
| A0A2X1QAC0 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.