DPCstruct | MC32264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 159 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8GAN8 | 4-151 | ALKVKANATAAQALDQGLTLEQSAVIEEFADDADAVALLERLATENPGNFAHRAQRLRDERRNNALIAEACAEAAAKGLTVLEEDPG… |
| A0A7V8XZL4 | 3-159 | LARKATERWDFLTLDQAAALAEFEDDTEATKALVAGAKEGQFEHVVQRLRDARDEAQALAEVAAELTAAGATVIERPGYNSPILRLD… |
| A0A1S1PBS3 | 93-263 | None |
| A0A0L6CPN2 | 12-172 | None |
| A0A848RZ62 | 3-165 | None |
| A0A3D9SX68 | 171-339 | None |
| A0A5D0XJV9 | 135-283 | None |
| A0A1G8PIS3 | 2-152 | None |
| A0A3E0W945 | 46-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.