DPCstruct | MC32263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 144 ± 11 aa |
| Standard deviation of domain lengths | 10.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.33 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0323- PF12536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1YP12 | 6-160 | DNNIPKLRYVIINLHPAKQEYLPFDYDGVVDRKNDIIYHDRTQFDENVAVLMSDFATFAESLIKLAEEKGASKEALQKILTEKTKGV… |
| A0A7D5R7Y6 | 216-363 | PKLDVVQINLNPARVNTVPFDYDGVKNRVSDIVFADRTKNDETILLFLQSFQEMTKKLINMSIEQGIKQEVIDKMLDAPLPMQHRFV… |
| A0A2V2UDM8 | 182-335 | None |
| A0A7W8XWA5 | 1-147 | None |
| A0A3A8KGL5 | 1-126 | None |
| X6EFS6 | 37-171 | None |
| A0A8A3LU07 | 62-192 | None |
| A0A1G6K5J3 | 5-161 | None |
| A0A6J4HBY8 | 63-217 | None |
| A0A3S4IX29 | 10-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.