DPCstruct | MC32261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 70 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.27 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0361- CL0167- CL0416 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8FGQ3 | 8-74 | GQTVLKGLGVKFGATVRKRYSKAYRTLKQKRRCPSCGSNKFCRIALGVWYCRKCSYKVAAGAYDVAT |
| A0A2K6NLB7 | 1-54 | MVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTFNTTSAVT |
| A0A340XK09 | 7-91 | None |
| A0A7I4CTP9 | 2-46 | None |
| A0A819XES9 | 1-65 | None |
| A0A533N9Z9 | 8-90 | None |
| A0A2D6NX31 | 8-64 | None |
| A0A4S2N782 | 2-46 | None |
| A0A444XEA3 | 207-284 | None |
| A0A7C5U3N1 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.