DPCstruct | MC32258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 188 ± 26 aa |
| Standard deviation of domain lengths | 25.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9MT61 | 136-375 | QNLQYVTTTFFHVFGDLDSIQTIDEVKHWGAVYLGLNEDRMDEYNEVSIWNDTQKAAVVFPTFTSAAYGEPGFYTYYRGECDECTTT… |
| A0A4R2DI60 | 172-339 | LLRLEADSGHQRYIPLIVRSTQGTGRTVLIHAPATWQAYNRWGGYSLYAGASGAYATRSLAVSFDRPYDADGAEKFMVYERAAVVLA… |
| A0A533UD12 | 6-269 | None |
| A0A535Z7D1 | 3-165 | None |
| A0A235IME3 | 624-788 | None |
| M3AZ61 | 327-527 | None |
| A0A2V4DH27 | 246-442 | None |
| A0A1X1UU19 | 77-282 | None |
| A0A2V2U9D3 | 120-304 | None |
| A0A6I6ULE8 | 198-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.