DPCstruct | MC32257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q8QJ48 | 18-71 | TKPFHVAVDRQLKSEHESYEAAEKAAIEIKKRHPKLHVTVFDAKEQRHTPVELP |
| A0A5S4YLT1 | 4-60 | PGLNLPTSGYAIIVDGLVKTEFATTDGVEIGAKDLKRRFPILQVEIFDAAVQAARDV |
| I4EB31 | 29-98 | None |
| A0A1M3C8K6 | 1-67 | None |
| A0A1M5RMH6 | 50-132 | None |
| A0A537U380 | 24-110 | None |
| A0A3S0H042 | 41-110 | None |
| A0A363TFE5 | 9-77 | None |
| Q1QFY5 | 38-107 | None |
| A0A7S7UAS2 | 4-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.