DPCstruct | MC32253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M4G2C7 | 1-86 | MKVTIWNEFRHEKNDLPVKEIYPEGIHTIIKRFLEKAGIESVATATLDEPEHGLTDEVLQNTDVLIWWGHQAHDDVREEIVEKVKN |
| A0A0N0I6B6 | 2-76 | TTPIRVVVWNEFRHEKKDEQVRAIYPEGMHTVIASYLAEAGFDAATAVLDEPEHGLTDEVLDRCDVLVWWGISPM |
| A0A0Q7JKK8 | 1-91 | None |
| R9JDL4 | 2-83 | None |
| A0A1I3D3X9 | 1-75 | None |
| A0A368VS54 | 16-100 | None |
| A0A535N873 | 421-506 | None |
| A0A830GMC8 | 7-67 | None |
| A0A810MN72 | 1-75 | None |
| A0A0K8Q4Q8 | 4-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.