DPCstruct | MC32252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A161RRX9 | 32-128 | QHQDLDYTFVPDNVPQSFIHSVKPFFDRAEEIYTFWHKALIAYKKFNFRTPIEQLTSTVIEAFKTSVFHYKKRKIKTSFTQYFYGTV… |
| A0A0N0I5L8 | 1-103 | MQKENLDGSYTSNRVPVEFRDLVKCFFDDYKTIEELWKVISIQTYYLSYYTKQDKLNLAIDSFKQLVRNIKRGRKVRNIYAYFWGIV… |
| A0A1H3JDB1 | 1-108 | None |
| A0A1B9AV97 | 109-212 | None |
| A0A6G7JL72 | 186-283 | None |
| I3DW97 | 1-99 | None |
| A0A7Y8WSF6 | 2-103 | None |
| C2WB07 | 98-190 | None |
| A0A239MG89 | 70-164 | None |
| A0A268JCS7 | 87-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.