DPCstruct | MC32251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 165 ± 24 aa |
| Standard deviation of domain lengths | 24.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0I4C5 | 4-162 | KTGQEYMERLKRAKSSVYIHGQKVEDVTVHPAFRNVVRSMAALYDRQYEKPDKMLYRSPTTGQLVGMTFIQPTTIEELIARREATQE… |
| A0A1J1EFF9 | 3-174 | RTGAEYMEALKERPPNLWYKGERVQDPTTHPVFRGIVRTMAALYDLQHDPRYREVLTYEEEGKRHGMSFLIPKTKEDLKRRGRAYKL… |
| A0A318WF84 | 2-174 | None |
| A0A2N5GC85 | 13-197 | None |
| A0A0M1NXZ8 | 1-156 | None |
| A0A428WJC5 | 102-294 | None |
| A0A537MWH5 | 13-129 | None |
| A0A353G612 | 3-185 | None |
| A0A844HHN6 | 2-163 | None |
| A0A223E6N2 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.