DPCstruct | MC32250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 193 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3ZWY1 | 1-229 | MSPIEAAKSLEWSECYTQAHSEIQSAIKHQLDIHLPLYPKERYLQFTPRIFLTPELTSNKVTDIHFEFIGPDWAKPNGNPKTKRFWP… |
| A0A6N4J463 | 1-188 | MLIHTTPRFYTCRHSGPVELVDLRIEELGVHLQGGKELTTRQPYPNKRYVVACKKVGRKAMEGLLFETDGKIQRYTVTTRWALRAEF… |
| A0A7Y4DUL3 | 314-506 | None |
| A0A161SCN8 | 171-353 | None |
| A8ZPU3 | 27-203 | None |
| A0A1P9YEB7 | 19-219 | None |
| A0A1M7DIT0 | 13-215 | None |
| A0A161XFR9 | 28-222 | None |
| A0A0J9B0C6 | 1-183 | None |
| A0A5I5A1H1 | 2-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.