DPCstruct | MC3225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388KNT3 | 438-531 | LKEQDGFVEFIMSMHRTHSPLEVMMKMELWIREHMQDPERSTLRRLIPSVGIFYTPLHLVEAFKEYDEFASLSRRRYVPPNFAEIRH… |
| D8RR74 | 113-208 | RLKEQDGLIEFIISLHSTHSPIQVMEKMERWIKEHSEDPMRSTLSRLISSVGRFYTPLPLVRAFHEYDEFASLSRRRYVPPNFAEIR… |
| W7K3X0 | 66-157 | None |
| A0A3R6XH10 | 1-111 | None |
| D8RX38 | 144-237 | None |
| A0A194WA85 | 15-140 | None |
| D8TZT0 | 111-205 | None |
| A0A6A4ZUU0 | 8-104 | None |
| A0A559M8L3 | 17-138 | None |
| A0A1U7LV70 | 17-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.