DPCstruct | MC32245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 117 ± 26 aa |
| Standard deviation of domain lengths | 25.68 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 70.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7I5A6 | 1-114 | MATDNASRSQPDKNSTNTTDYWMNSVNITLSIPPDLTLEKGKLKWLNNFEDLKLFVKTTLQIEGTWSSPGGYLKAFSEDPESVLIRY… |
| A0A7D9HQA8 | 22-137 | LSKVYFMYKEFIECSNDGKVKWLGNLNDLKAFMSALFGDVGKWSSPGGSAKSYRNDLISINWYIHKKALIFHDQLGIVLKNKLIDLS… |
| A0A6S7G0G4 | 75-185 | None |
| A0A6S7G9J5 | 1-140 | None |
| A0A6S7HCZ6 | 26-134 | None |
| A0A6S7G061 | 6-140 | None |
| A0A7D9LLD4 | 19-105 | None |
| A0A7D9LNG4 | 116-216 | None |
| A0A7D9M4V5 | 4-121 | None |
| A0A7D9M9V6 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.