DPCstruct | MC32244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 256 ± 56 aa |
| Standard deviation of domain lengths | 55.73 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 96.23 |
| Assigned Pfam label(s) | PF21107- PF20209- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4TLG9 | 193-518 | RSKVKKMSIGKYREDALHRAKVKKMSIGKYQEDARHMAKVKKVSIRKYRVDALHMAKVKKMSIGKYWEDVLHREKLKKMSKSKYRRN… |
| A0A7D9HMB4 | 339-621 | ETVSERENRLAKQGEKRKQTKQQETITERENRLAKRGEKRKQAKQQETIIERENRLAKRGEKRKQAKQQETVSERENRLQNQRKARR… |
| A0A6S6V4L1 | 84-295 | None |
| A0A6S7HEC0 | 413-639 | None |
| A0A6S7HVR7 | 124-389 | None |
| A0A6S7I3C0 | 7-200 | None |
| A0A816EQE1 | 41-279 | None |
| A0A6S7IFJ3 | 357-690 | None |
| A0A6S7ILW5 | 24-215 | None |
| A0A7D9M1W2 | 3-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.