DPCstruct | MC32241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 239 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9HJH6 | 19-217 | WEKAKIYGRNSEKPLTKYQSAINEAAIAIAKEEPIVVLDRGNLLNKAKQKVMSDGYQFAKGKSRSKSASDAESEGSATKRAKLSSEE… |
| A0A2Z6SCL4 | 242-452 | KDVIIHHATIYGKNSPRQLTSYEQAINSAAIELALQDPALVANKGALFEKAKAKLLLGGYSYKRGASRSKLNPNAPKPGSRASRATL… |
| A0A6P8HUY5 | 158-468 | None |
| A0A812B7H8 | 1-231 | None |
| B7PC09 | 9-250 | None |
| A0A0A1NMH8 | 84-315 | None |
| I1CHT9 | 122-364 | None |
| A0A7D9DNQ8 | 91-337 | None |
| A0A2J7RK57 | 139-396 | None |
| A0A7D9JAT7 | 196-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.