DPCstruct | MC32239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.53 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | PF16165- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821SV09 | 113-215 | NFNWRFVFDFDYLDIEEKVIFEAKDSVFQVGNTKKKIPPRLIVRVYDADFFSADDFLGESIITLTHVPLGGKLSKKCKADILLNPKH… |
| A0A0S7GW93 | 32-142 | NFNWRFVFPFDYLVAEEKIVISKKESMFSWDETEYKIPPRLTMQVWDADHFSADDFLGAIELDLNRFPRGAKTAKLCNLDMIRNEQE… |
| A0A5N4DKS4 | 233-344 | None |
| A0A7J7KR59 | 23-131 | None |
| A0A7J7JIW2 | 2-86 | None |
| A0A7J7IXB1 | 253-349 | None |
| A0A815TFE2 | 287-392 | None |
| A0A183KCQ9 | 245-356 | None |
| A0A2G8KTL0 | 871-975 | None |
| A0A7F8QTZ7 | 82-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.