DPCstruct | MC32238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 225 |
|---|---|
| Mean domain length (aa) | 161 ± 32 aa |
| Standard deviation of domain lengths | 31.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 99.67 |
| Assigned Pfam label(s) | PF20209- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2L812 | 3-134 | VARVRHTAVFVRVATGGRKMKANAMAFESPIPKIYDILPPPKADIEEVLAILFTGPSAPTPEDFARTPLLVRRNAVKRALDWLVLNH… |
| A0A7D9E8W8 | 11-156 | PRKFSFENSMIPSPQPVQLHGLTQVEEMLIARALPIMRVYIKPGGQRGYSGHCVNLPQNITELATSLPRYPRALSVILVKVKGKNNT… |
| A0A4S8MA36 | 63-233 | None |
| A0A2V1CZB0 | 506-652 | None |
| A0A146H3V4 | 250-461 | None |
| M1WE44 | 33-186 | None |
| A0A0G4HSP8 | 208-366 | None |
| A0A284R8P7 | 441-657 | None |
| A0A284RAN5 | 276-425 | None |
| A0A819XUZ2 | 158-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.