DPCstruct | MC32237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0XIZ3 | 423-544 | DDARRKVQILSEAPQTVDFAHYRSTLKNTAVVDEIEKHFSSFKPKTYDVGRQIKAIEAFEAQAVKNAEETKGKVDAELKDLEKTLRN… |
| A0A212CLY1 | 161-252 | STLQPCGWKPPATDWIYYKANMAKADLVDDFEKKFTALKFPMPEHKYSAQVDAEETEDVKSCAEFLSLWKSRIQEYEKDLEVKDIIT… |
| A0A482XEE2 | 36-163 | None |
| A0A3P4LZA3 | 6-95 | None |
| A0A1S9DA01 | 38-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.