DPCstruct | MC32227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1FVG6 | 102-242 | SQLQHQLAKLPADKHFILRVNDGGMGHAYVIDLPASAKPHRDAFLYQSDLGDGATRPLRLEDWMSRKAAHPIALNDINKHFNNMASG… |
| A0A0K4D6U8 | 1-135 | MPECKSFVLRVNDGALGHAYIVDIPKGENSCRPAFLYQSDLGEGVTRKLRFEDWMTHKALTPILLDDICNYFSCMSQNKTDLEQIAT… |
| A0A4Q6ACS9 | 106-260 | None |
| A0A510USL8 | 254-401 | None |
| A0A3B6WHM1 | 182-307 | None |
| A0A160FPN4 | 10-156 | None |
| I2WLH4 | 67-210 | None |
| A0A5P9CNX1 | 1-151 | None |
| A0A826P931 | 139-273 | None |
| A0A829QS71 | 4-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.