DPCstruct | MC3222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2TVC8 | 1-83 | MGDVGGRTKLLAGYERMNQAARVSHRDVVAFVRDRRLHGCGVGWVDVHLLASAPVGRLRLWTADLHFAEIAEELGIAYKPPSS |
| A0A6B0Y3S6 | 38-124 | ELACGNLPDRAAKMAMLQGLPRISELSNNVVTARIEQRKLMGRGIGFVDAHLVLSAVERKDTRFWTRDRRLHQVAGDLGVAFVEDDG |
| A0A3P0RSE5 | 7-90 | None |
| A0A450Y0A5 | 2-81 | None |
| A0A1F4CHZ6 | 1-67 | None |
| A0A395KWV7 | 2-73 | None |
| A0A1D8IPH1 | 8-75 | None |
| C5D048 | 18-106 | None |
| A0A5M8UBJ1 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.